United States
Germany
Japan
United Kingdom
China
APE1 (APEX1) (NM_080649) Human Mass Spec Standard
CAT＃: PH313298
APEX1 MS Standard C13 and N15-labeled recombinant protein (NP_542380)
View other "APE1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
热销推荐Specifications
| Product Data | |
| Description | APEX1 MS Standard C13 and N15-labeled recombinant protein (NP_542380) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213298 |
| Predicted MW | 35.6 kDa |
| Protein Sequence |
>RC213298 protein sequence
Red=Cloning site Green=Tags(s) MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVD GLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPL KVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGD LNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGW RLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_542380 |
| RefSeq Size | 1507 |
| RefSeq ORF | 954 |
| Synonyms | APE; APE1; APEN; APEX; APX; HAP1; REF1 |
| Locus ID | 328 |
| Cytogenetics | 14q11.2 |
| Summary | The APEX gene encodes the major AP endonuclease in human cells. It encodes the APEX endonuclease, a DNA repair enzyme with apurinic/apyrimidinic (AP) activity. Such AP activity sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. The AP sites are the most frequent pre-mutagenic lesions that can prevent normal DNA replication. Splice variants have been found for this gene; all encode the same protein. Disruptions in the biological functions related to APEX are associated with many various malignancies and neurodegenerative diseases.[provided by RefSeq, Dec 2019] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Base excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400618 | APEX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409118 | APEX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409119 | APEX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429949 | APEX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400618 | Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 1 |
CNY 3,080.00 |
|
| LY409118 | Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2 |
CNY 3,080.00 |
|
| LY409119 | Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 3 |
CNY 3,080.00 |
|
| LY429949 | Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 3 |
CNY 3,080.00 |
|
| PH301208 | APEX1 MS Standard C13 and N15-labeled recombinant protein (NP_542379) |
CNY 19,520.00 |
|
| TP301208 | Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP313298 | Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP720082 | Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 1 |
CNY 1,800.00 |
|
| TP760021 | Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
