TOLLIP (NM_019009) Human Recombinant Protein
CAT#: TP300227
Recombinant protein of human toll interacting protein (TOLLIP), 20 µg
View other "TOLLIP" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200227 protein sequence
Red=Cloning site Green=Tags(s) MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGM TRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPE SLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCS PGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061882 |
Locus ID | 54472 |
UniProt ID | Q9H0E2 |
Refseq Size | 3665 |
Cytogenetics | 11p15.5 |
Refseq ORF | 822 |
Synonyms | IL-1RAcPIP |
Summary | This gene encodes a ubiquitin-binding protein that interacts with several Toll-like receptor (TLR) signaling cascade components. The encoded protein regulates inflammatory signaling and is involved in interleukin-1 receptor trafficking and in the turnover of IL1R-associated kinase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402724 | TOLLIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402724 | Transient overexpression lysate of toll interacting protein (TOLLIP) |
CNY 3,080.00 |
|
PH300227 | TOLLIP MS Standard C13 and N15-labeled recombinant protein (NP_061882) |
CNY 19,520.00 |
|
TP720557 | Recombinant protein of human toll interacting protein (TOLLIP) |
CNY 3,140.00 |