WDR79 (WRAP53) (NM_018081) Human Recombinant Protein
CAT#: TP300142
Recombinant protein of human WD repeat containing, antisense to TP53 (WRAP53), transcript variant 1, 20 µg
View other "WDR79" proteins (15)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200142 protein sequence
Red=Cloning site Green=Tags(s) MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREG DPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAED EGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVE YAEMVPVLRMVEGDTIYDYCWYSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLG LYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFD LDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE SGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGVGELI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060551 |
Locus ID | 55135 |
UniProt ID | Q9BUR4 |
Refseq Size | 1982 |
Cytogenetics | 17p13.1 |
Refseq ORF | 1644 |
Synonyms | DKCB3; TCAB1; WDR79 |
Summary | This gene encodes an essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex required for telomere synthesis. This protein is enriched in Cajal bodies, nuclear sites of RNP processing that are important for telomerase function. It interacts with dyskerin, TERT and TERC, other components of active telomerase, and with small Cajal body RNAs (scaRNAs), which are involved in modifying splicing RNAs. This mRNA also functions as a p53 antisense transcript, that regulates endogenous p53 mRNA levels and further induction of p53 protein by targeting the 5' untranslated region of p53 mRNA. Alternatively spliced transcript variants which differ only in the 5' UTR have been found for this gene. [provided by RefSeq, Mar 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413323 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428450 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428451 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428452 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413323 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 1 |
CNY 3,080.00 |
|
LY428450 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 2 |
CNY 3,080.00 |
|
LY428451 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 3 |
CNY 3,080.00 |
|
LY428452 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 4 |
CNY 3,080.00 |
|
PH300142 | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_060551) |
CNY 19,520.00 |
|
PH327755 | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137462) |
CNY 14,250.00 |
|
PH327773 | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137463) |
CNY 14,250.00 |
|
PH327786 | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137464) |
CNY 14,250.00 |
|
TP327755 | Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP327773 | Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP327786 | Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 4, 20 µg |
CNY 2,900.00 |