United States
Germany
Japan
United Kingdom
China
WDR79 (WRAP53) (NM_018081) Human Mass Spec Standard
CAT＃: PH300142
WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_060551)
View other "WDR79" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_060551) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200142 |
| Predicted MW | 59.3 kDa |
| Protein Sequence |
>RC200142 protein sequence
Red=Cloning site Green=Tags(s) MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREG DPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAED EGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVE YAEMVPVLRMVEGDTIYDYCWYSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLG LYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFD LDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE SGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGVGELI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060551 |
| RefSeq Size | 1982 |
| RefSeq ORF | 1644 |
| Synonyms | DKCB3; TCAB1; WDR79 |
| Locus ID | 55135 |
| Cytogenetics | 17p13.1 |
| Summary | This gene encodes an essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex required for telomere synthesis. This protein is enriched in Cajal bodies, nuclear sites of RNP processing that are important for telomerase function. It interacts with dyskerin, TERT and TERC, other components of active telomerase, and with small Cajal body RNAs (scaRNAs), which are involved in modifying splicing RNAs. This mRNA also functions as a p53 antisense transcript, that regulates endogenous p53 mRNA levels and further induction of p53 protein by targeting the 5' untranslated region of p53 mRNA. Alternatively spliced transcript variants which differ only in the 5' UTR have been found for this gene. [provided by RefSeq, Mar 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413323 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428450 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428451 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428452 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413323 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 1 |
CNY 3,080.00 |
|
| LY428450 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 2 |
CNY 3,080.00 |
|
| LY428451 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 3 |
CNY 3,080.00 |
|
| LY428452 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 4 |
CNY 3,080.00 |
|
| PH327755 | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137462) |
CNY 14,250.00 |
|
| PH327773 | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137463) |
CNY 14,250.00 |
|
| PH327786 | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137464) |
CNY 14,250.00 |
|
| TP300142 | Recombinant protein of human WD repeat containing, antisense to TP53 (WRAP53), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP327755 | Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP327773 | Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP327786 | Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 4, 20 µg |
CNY 2,900.00 |
