14 3 3 eta (YWHAH) (NM_003405) Human Recombinant Protein
CAT#: TP300013
Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 20 µg
View other "14 3 3 eta" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200013 protein sequence
Red=Cloning site Green=Tags(s) MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKT MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASG EKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDT LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003396 |
Locus ID | 7533 |
UniProt ID | Q04917, A0A024R1K7, Q9H4N8 |
Refseq Size | 1807 |
Cytogenetics | 22q12.3 |
Refseq ORF | 738 |
Synonyms | YWHA1 |
Summary | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq, Jun 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418678 | YWHAH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418678 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH) |
CNY 3,080.00 |
|
PH300013 | YWHAH MS Standard C13 and N15-labeled recombinant protein (NP_003396) |
CNY 19,520.00 |
其它14 3 3 eta产品