14 3 3 eta (YWHAH) (NM_003405) Human Mass Spec Standard
CAT#: PH300013
YWHAH MS Standard C13 and N15-labeled recombinant protein (NP_003396)
View other "14 3 3 eta" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | YWHAH MS Standard C13 and N15-labeled recombinant protein (NP_003396) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200013 |
Predicted MW | 28.2 kDa |
Protein Sequence |
>RC200013 protein sequence
Red=Cloning site Green=Tags(s) MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKT MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASG EKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDT LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003396 |
RefSeq Size | 1807 |
RefSeq ORF | 738 |
Synonyms | YWHA1 |
Locus ID | 7533 |
Cytogenetics | 22q12.3 |
Summary | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq, Jun 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418678 | YWHAH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418678 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH) |
CNY 3,080.00 |
|
TP300013 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 20 µg |
CNY 2,900.00 |
其它14 3 3 eta产品