14 3 3 eta (YWHAH) Rabbit Polyclonal Antibody

CAT#: TA330344

Rabbit Polyclonal Anti-YWHAH Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-YWHAH antibody: synthetic peptide directed towards the N terminal of human YWHAH. Synthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 28 kDa
Gene Name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta
Background The YWHAH gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat has been associated with early-onset schizophrenia.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat has been associated with early-onset schizophrenia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms YWHA1
Note Immunogen sequence homology: Chicken: 100%; Dog: 100%; Human: 100%; Rabbit: 100%; African clawed frog: 93%; Zebrafish: 78%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...