Dystrophia myotonica protein kinase (DMPK) (NM_001081562) Human Mass Spec Standard
CAT#: PH323643
DMPK MS Standard C13 and N15-labeled recombinant protein (NP_001075031)
View other "Dystrophia myotonica protein kinase" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DMPK MS Standard C13 and N15-labeled recombinant protein (NP_001075031) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223643 |
Predicted MW | 69.4 kDa |
Protein Sequence |
>RC223643 representing NM_001081562
Red=Cloning site Green=Tags(s) MSAEVRLRRLQQLVLDPGFLGLEPLLDLLLGVHQELGASELAQDKYVADFLQWAEPIVVRLKEVRLQRDD FEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFREERDVLVNGDRRWITQLHFAFQD ENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIVMAIDSVHRLGYVHRDIKPDNILLDRCGHIR LADFGSCLKLRADGTVRSLVAVGTPDYLSPEILQAVGGGPGTGSYGPECDWWALGVFAYEMFYGQTPFYA DSTAETYGKIVHYKEHLSLPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDS VPPFTPDFEGATDTCNFDLVEDGLTAMETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTPMELEA EQLLEPHVQAPSLEPSVSPQDETAEVAVPAAVPAAEAEAEVTLRELQEALEEEVLTRQSLSREMEAIRTD NQNFASQLREAEARNRDLEAHVRQLQERMELLQAEGATAVTGVPSPRATDPPSHMAPRPWLWASARWWGQ APCTAATCCSLPGSLGLAYRRRFPCSCSPLFCLVPPPWAALGWWPTPANSPQSGAAQEPPALPEP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001075031 |
RefSeq Size | 2873 |
RefSeq ORF | 1875 |
Synonyms | DM; DM1; DM1PK; DMK; MDPK; MT-PK |
Locus ID | 1760 |
Cytogenetics | 19q13.32 |
Summary | The protein encoded by this gene is a serine-threonine kinase that is closely related to other kinases that interact with members of the Rho family of small GTPases. Substrates for this enzyme include myogenin, the beta-subunit of the L-type calcium channels, and phospholemman. The 3' untranslated region of this gene contains 5-38 copies of a CTG trinucleotide repeat. Expansion of this unstable motif to 50-5,000 copies causes myotonic dystrophy type I, which increases in severity with increasing repeat element copy number. Repeat expansion is associated with condensation of local chromatin structure that disrupts the expression of genes in this region. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418004 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421164 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421165 | DMPK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY418004 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 2 |
CNY 3,080.00 |
|
LY421164 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 3 |
CNY 4,840.00 |
|
LY421165 | Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 4 |
CNY 4,840.00 |
|
PH309151 | DMPK MS Standard C13 and N15-labeled recombinant protein (NP_004400) |
CNY 19,520.00 |
|
TP309151 | Recombinant protein of human dystrophia myotonica-protein kinase (DMPK), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP323643 | Recombinant protein of human dystrophia myotonica-protein kinase (DMPK), transcript variant 4, 20 µg |
CNY 2,900.00 |
其它Dystrophia myotonica protein kinase产品