Flt3 ligand (FLT3LG) (NM_001459) Human Mass Spec Standard
CAT#: PH322242
FLT3LG MS Standard C13 and N15-labeled recombinant protein (NP_001450)
View other "Flt3 ligand" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
CN¥ 3,080.00
CN¥ 3,990.00
Specifications
Product Data | |
Description | FLT3LG MS Standard C13 and N15-labeled recombinant protein (NP_001450) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222242 |
Predicted MW | 26.4 kDa |
Protein Sequence |
>RC222242 protein sequence
Red=Cloning site Green=Tags(s) MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELC GGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVA LKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRT RRRTPRPGEQVPPVPSPQDLLLVEH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001450 |
RefSeq Size | 1074 |
RefSeq ORF | 705 |
Synonyms | FL; FLG3L; FLT3L |
Locus ID | 2323 |
Cytogenetics | 19q13.33 |
Summary | Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).[supplied by OMIM, Jan 2011] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419927 | FLT3LG HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419927 | Transient overexpression lysate of fms-related tyrosine kinase 3 ligand (FLT3LG) |
CN¥ 3,080.00 |
|
TP322242 | Recombinant protein of human fms-related tyrosine kinase 3 ligand (FLT3LG), 20 µg |
CN¥ 2,900.00 |
|
TP721050 | Purified recombinant protein of Human fms-related tyrosine kinase 3 ligand (FLT3LG), transcript variant 3 |
CN¥ 1,800.00 |
其它Flt3 ligand产品