United States
Germany
Japan
United Kingdom
China
FXYD6 (NM_022003) Human Mass Spec Standard
CAT＃: PH310607
FXYD6 MS Standard C13 and N15-labeled recombinant protein (NP_071286)
View other "FXYD6" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | FXYD6 MS Standard C13 and N15-labeled recombinant protein (NP_071286) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210607 |
| Predicted MW | 10.5 kDa |
| Protein Sequence |
>RC210607 protein sequence
Red=Cloning site Green=Tags(s) MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR APGDEEAQVENLITANATEPQKAEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_071286 |
| RefSeq Size | 2056 |
| RefSeq ORF | 285 |
| Locus ID | 53826 |
| Cytogenetics | 11q23.3 |
| Summary | This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.[provided by RefSeq, Feb 2011] |
| Protein Families | Ion Channels: Other, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411842 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431748 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431749 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431750 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431751 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411842 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1 |
CNY 3,080.00 |
|
| LY431748 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 3 |
CNY 3,080.00 |
|
| LY431749 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4 |
CNY 3,080.00 |
|
| LY431750 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 2 |
CNY 3,080.00 |
|
| LY431751 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 5 |
CNY 3,080.00 |
|
| TP310607 | Recombinant protein of human FXYD domain containing ion transport regulator 6 (FXYD6), 20 µg |
CNY 2,900.00 |
|
| TP328720 | Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP328721 | Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4, 20 µg |
CNY 2,900.00 |
