FXYD6 (NM_022003) Human Tagged ORF Clone
CAT#: RC210607
FXYD6 (Myc-DDK-tagged)-Human FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1
ORF Plasmid: tGFP
"NM_022003" in other vectors (5)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210607 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGTTGGTGCTGGTCTTCCTCTGCAGCCTGCTGGCCCCCATGGTCCTGGCCAGTGCAGCTGAAAAGG AGAAGGAAATGGACCCTTTTCATTATGATTACCAGACCCTGAGGATTGGGGGACTGGTGTTCGCTGTGGT CCTCTTCTCGGTTGGGATCCTCCTTATCCTAAGTCGCAGGTGCAAGTGCAGTTTCAATCAGAAGCCCCGG GCCCCAGGAGATGAGGAAGCCCAGGTGGAGAACCTCATCACCGCCAATGCAACAGAGCCCCAGAAAGCAG AGAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210607 protein sequence
Red=Cloning site Green=Tags(s) MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR APGDEEAQVENLITANATEPQKAEN myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_022003 |
ORF Size | 285 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_022003.4 |
RefSeq Size | 2056 bp |
RefSeq ORF | 288 bp |
Locus ID | 53826 |
UniProt ID | Q9H0Q3 |
Domains | ATP1G1_PLM_MAT8 |
Protein Families | Ion Channels: Other, Transmembrane |
MW | 10.5 kDa |
Gene Summary | This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.[provided by RefSeq, Feb 2011] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Sphingolipid subtypes differentially control proinsulin processing and systemic glucose homeostasis
,null,
Nature Cell Biology
,PubMed ID 36543979
[FXYD6]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210607L3 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC210607L4 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG210607 | FXYD6 (tGFP-tagged) - Human FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1 |
CNY 2,800.00 |
|
SC112567 | FXYD6 (untagged)-Human FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1 |
CNY 1,200.00 |
|
SC322066 | FXYD6 (untagged)-Human FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1 |
CNY 1,200.00 |