FXYD6 (NM_001164836) Human Recombinant Protein
CAT#: TP328721
Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4, 20 µg
View other "FXYD6" proteins (13)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228721 protein sequence
Red=Cloning site Green=Tags(s) MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR APGDEEAQVENLITANATEPQKAEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001158308 |
Locus ID | 53826 |
UniProt ID | Q9H0Q3 |
Refseq Size | 2229 |
Cytogenetics | 11q23.3 |
Refseq ORF | 285 |
Summary | This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.[provided by RefSeq, Feb 2011] |
Protein Families | Ion Channels: Other, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411842 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431748 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431749 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431750 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431751 | FXYD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411842 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 1 |
CNY 3,080.00 |
|
LY431748 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 3 |
CNY 3,080.00 |
|
LY431749 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4 |
CNY 3,080.00 |
|
LY431750 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 2 |
CNY 3,080.00 |
|
LY431751 | Transient overexpression lysate of FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 5 |
CNY 3,080.00 |
|
PH310607 | FXYD6 MS Standard C13 and N15-labeled recombinant protein (NP_071286) |
CNY 19,520.00 |
|
TP310607 | Recombinant protein of human FXYD domain containing ion transport regulator 6 (FXYD6), 20 µg |
CNY 2,900.00 |
|
TP328720 | Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 3, 20 µg |
CNY 2,900.00 |