LDHA (NM_005566) Human Mass Spec Standard
CAT#: PH309378
LDHA MS Standard C13 and N15-labeled recombinant protein (NP_005557)
View other "LDHA" proteins (8)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
CN¥ 3,080.00
CN¥ 1,999.00
CN¥ 2,700.00
Specifications
Product Data | |
Description | LDHA MS Standard C13 and N15-labeled recombinant protein (NP_005557) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209378 |
Predicted MW | 36.5 kDa |
Protein Sequence |
>RC209378 representing NM_005566
Red=Cloning site Green=Tags(s) MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSL FLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPV DILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVS LKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGL YGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005557 |
RefSeq Size | 1661 |
RefSeq ORF | 996 |
Synonyms | GSD11; HEL-S-133P; LDHM; PIG19 |
Locus ID | 3939 |
Cytogenetics | 11p15.1 |
Summary | The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. [provided by RefSeq, Sep 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401712 | LDHA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC427601 | LDHA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC431321 | LDHA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401712 | Transient overexpression lysate of lactate dehydrogenase A (LDHA), transcript variant 1 |
CN¥ 3,080.00 |
|
LY427601 | Transient overexpression lysate of lactate dehydrogenase A (LDHA), transcript variant 2 |
CN¥ 3,080.00 |
|
LY431321 | Transient overexpression lysate of lactate dehydrogenase A (LDHA), transcript variant 3 |
CN¥ 3,080.00 |
|
TP309378 | Recombinant protein of human lactate dehydrogenase A (LDHA), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP720209 | Recombinant protein of human lactate dehydrogenase A (LDHA), transcript variant 2 |
CN¥ 1,800.00 |