LDHA (NM_005566) Human Tagged ORF Clone
CAT#: RC209378
LDHA (Myc-DDK-tagged)-Human lactate dehydrogenase A (LDHA), transcript variant 1
ORF Plasmid: tGFP
"NM_005566" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
Cited in 8 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | GSD11; HEL-S-133P; LDHM; PIG19 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC209378 representing NM_005566
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAACTCTAAAGGATCAGCTGATTTATAATCTTCTAAAGGAAGAACAGACCCCCCAGAATAAGATTA CAGTTGTTGGGGTTGGTGCTGTTGGCATGGCCTGTGCCATCAGTATCTTAATGAAGGACTTGGCAGATGA ACTTGCTCTTGTTGATGTCATCGAAGACAAATTGAAGGGAGAGATGATGGATCTCCAACATGGCAGCCTT TTCCTTAGAACACCAAAGATTGTCTCTGGCAAAGACTATAATGTAACTGCAAACTCCAAGCTGGTCATTA TCACGGCTGGGGCACGTCAGCAAGAGGGAGAAAGCCGTCTTAATTTGGTCCAGCGTAACGTGAACATCTT TAAATTCATCATTCCTAATGTTGTAAAATACAGCCCGAACTGCAAGTTGCTTATTGTTTCAAATCCAGTG GATATCTTGACCTACGTGGCTTGGAAGATAAGTGGTTTTCCCAAAAACCGTGTTATTGGAAGTGGTTGCA ATCTGGATTCAGCCCGATTCCGTTACCTGATGGGGGAAAGGCTGGGAGTTCACCCATTAAGCTGTCATGG GTGGGTCCTTGGGGAACATGGAGATTCCAGTGTGCCTGTATGGAGTGGAATGAATGTTGCTGGTGTCTCT CTGAAGACTCTGCACCCAGATTTAGGGACTGATAAAGATAAGGAACAGTGGAAAGAGGTTCACAAGCAGG TGGTTGAGAGTGCTTATGAGGTGATCAAACTCAAAGGCTACACATCCTGGGCTATTGGACTCTCTGTAGC AGATTTGGCAGAGAGTATAATGAAGAATCTTAGGCGGGTGCACCCAGTTTCCACCATGATTAAGGGTCTT TACGGAATAAAGGATGATGTCTTCCTTAGTGTTCCTTGCATTTTGGGACAGAATGGAATCTCAGACCTTG TGAAGGTGACTCTGACTTCTGAGGAAGAGGCCCGTTTGAAGAAGAGTGCAGATACACTTTGGGGGATCCA AAAGGAGCTGCAATTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC209378 representing NM_005566
Red=Cloning site Green=Tags(s) MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSL FLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPV DILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVS LKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGL YGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005566 |
ORF Size | 996 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005566.4 |
RefSeq Size | 1661 bp |
RefSeq ORF | 999 bp |
Locus ID | 3939 |
UniProt ID | P00338 |
Domains | ldh |
Protein Families | Druggable Genome |
Protein Pathways | Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism |
MW | 36.5 kDa |
Gene Summary | The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. [provided by RefSeq, Sep 2008] |
Citations (8)
The use of this cDNA Clones has been cited in the following citations: |
---|
Influences of the lncRNA TUG1‐miRNA‐34a‐5p network on fibroblast‐like synoviocytes (FLSs) dysfunction in rheumatoid arthritis through targeting the lactate dehydrogenase A (LDHA). Influences of the lncRNA TUG1‐miRNA‐34a‐5p network on fibroblast‐like synoviocytes (FLSs) dysfunction in rheumatoid arthritis through targeting the lactate dehydrogenase A (LDHA)
,null,
Journal of Clinical Laboratory Analysis
,PubMed ID 34403518
[LDHA]
|
Inhibition of lncRNA-NEAT1 sensitizes 5-Fu resistant cervical cancer cells through de-repressing the microRNA-34a/LDHA axis
,Shao, X;Zheng, X;Ma, D;Liu, Y;Liu, G;,
Bioscience reports
,PubMed ID 33645623
[LDHA]
|
Overcoming cetuximab resistance in Ewing's sarcoma by inhibiting lactate dehydrogenase-A
,Fu, J;Jiang, H;Wu, C;Jiang, Y;Xiao, L;Tian, Y;,
Mol Med Rep
,PubMed ID 27222229
[LDHA]
|
Sensitization of hepatocellular carcinoma cells to irradiation by miR-34a through targeting lactate dehydrogenase-A
,Li, X;Lu, P;Li, B;Yang, R;Chu, Y;Zhang, Z;Wan, H;Niu, C;Wang, C;Luo, K;,
Mol Med Rep
,PubMed ID 26956717
[LDHA]
|
Synergistic cytotoxicity of cisplatin and Taxol in overcoming Taxol resistance through the inhibition of LDHA in oral squamous cell carcinoma
,null,
Oncology Letters
,PubMed ID 25789051
[LDHA]
|
Synergistic cytotoxicity of cisplatin and Taxol in overcoming Taxol resistance through the inhibition of LDHA in oral squamous cell carcinoma
,Feng, L;Soloveiv, MM;Wang, DS;,
Oncology Letters
[LDHA]
|
Inhibition of lactate dehydrogenase A by microRNA-34a resensitizes colon cancer cells to 5-fluorouracil
,Li, X;Zhao, H;Zhou, X;Song, L;,
Mol Med Rep
,PubMed ID 25333573
[LDHA]
|
Re-sensitization of 5-FU resistance by SPARC through negative regulation of glucose metabolism in hepatocellular carcinoma
,Hua, HW;Jiang, F;Huang, Q;Liao, ZJ;Ding, G;,
Tumour Biol.
,PubMed ID 25252848
[LDHA]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC209378L1 | Lenti ORF clone of Human lactate dehydrogenase A (LDHA), transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC209378L2 | Lenti ORF clone of Human lactate dehydrogenase A (LDHA), transcript variant 1, mGFP tagged |
CNY 6,000.00 |
|
RC209378L3 | Lenti ORF clone of Human lactate dehydrogenase A (LDHA), transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC209378L4 | Lenti ORF clone of Human lactate dehydrogenase A (LDHA), transcript variant 1, mGFP tagged |
CNY 6,000.00 |
|
RG209378 | LDHA (tGFP-tagged) - Human lactate dehydrogenase A (LDHA), transcript variant 1 |
CNY 5,200.00 |
|
SC116656 | LDHA (untagged)-Human lactate dehydrogenase A (LDHA), transcript variant 1 |
CNY 3,600.00 |
|
SC320978 | LDHA (untagged)-Human lactate dehydrogenase A (LDHA), transcript variant 1 |
CNY 3,600.00 |