United States
Germany
Japan
United Kingdom
China
CD244 (NM_016382) Human Mass Spec Standard
CAT＃: PH306988
CD244 MS Standard C13 and N15-labeled recombinant protein (NP_057466)
View other "CD244" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
热销推荐Specifications
| Product Data | |
| Description | CD244 MS Standard C13 and N15-labeled recombinant protein (NP_057466) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206988 |
| Predicted MW | 41.1 kDa |
| Protein Sequence |
>RC206988 protein sequence
Red=Cloning site Green=Tags(s) MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWE NGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKI LDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLT QDCQNAHQEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQ EQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNP ARLSRKELENFDVYS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057466 |
| RefSeq Size | 2528 |
| RefSeq ORF | 1095 |
| Synonyms | 2B4; NAIL; NKR2B4; Nmrk; SLAMF4 |
| Locus ID | 51744 |
| Cytogenetics | 1q23.3 |
| Summary | This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413990 | CD244 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432954 | CD244 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413990 | Transient overexpression lysate of CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 1 |
CNY 3,080.00 |
|
| LY432954 | Transient overexpression lysate of CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 2 |
CNY 3,080.00 |
|
| TP306988 | Recombinant protein of human CD244 molecule, natural killer cell receptor 2B4 (CD244), 20 µg |
CNY 2,900.00 |
|
| TP329806 | Purified recombinant protein of Homo sapiens CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP723933 | Human 2B4 Protein, mFc-His Tag |
CNY 5,552.00 |
|
| TP724012 | Human 2B4 Protein, hFc tag |
CNY 5,876.00 |
