United States
Germany
Japan
United Kingdom
China
CD244 (NM_001166664) Human Recombinant Protein
CAT＃: TP329806
Purified recombinant protein of Homo sapiens CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 3, 20 µg
View other "CD244" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC229806 representing NM_001166664
Red=Cloning site Green=Tags(s) MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWE NGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFEFRFWPFLVIIVIL SALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAP TSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.2 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001160136 |
| Locus ID | 51744 |
| UniProt ID | Q9BZW8 |
| Cytogenetics | 1q23.3 |
| Refseq ORF | 819 |
| Synonyms | 2B4; NAIL; NKR2B4; Nmrk; SLAMF4 |
| Summary | This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413990 | CD244 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432954 | CD244 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413990 | Transient overexpression lysate of CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 1 |
CNY 3,080.00 |
|
| LY432954 | Transient overexpression lysate of CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 2 |
CNY 3,080.00 |
|
| PH306988 | CD244 MS Standard C13 and N15-labeled recombinant protein (NP_057466) |
CNY 19,520.00 |
|
| TP306988 | Recombinant protein of human CD244 molecule, natural killer cell receptor 2B4 (CD244), 20 µg |
CNY 2,900.00 |
|
| TP723933 | Human 2B4 Protein, mFc-His Tag |
CNY 5,552.00 |
|
| TP724012 | Human 2B4 Protein, hFc tag |
CNY 5,876.00 |
