United States
Germany
Japan
United Kingdom
China
IL1RA (IL1RN) (NM_173843) Human Mass Spec Standard
CAT＃: PH302447
IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776215)
View other "IL1RA" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776215) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202447 |
| Predicted MW | 17.9 kDa |
| Protein Sequence |
>RC202447 protein sequence
Red=Cloning site Green=Tags(s) MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGG KMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSL TNMPDEGVMVTKFYFQEDE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_776215 |
| RefSeq Size | 1973 |
| RefSeq ORF | 480 |
| Synonyms | DIRA; ICIL-1RA; IL-1ra; IL-1ra3; IL-1RN; IL1F3; IL1RA; IRAP; MVCD4 |
| Locus ID | 3557 |
| Cytogenetics | 2q14.1 |
| Summary | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Aug 2020] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403570 | IL1RN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403571 | IL1RN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406440 | IL1RN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424628 | IL1RN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403570 | Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 1 |
CNY 3,080.00 |
|
| LY403571 | Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 4 |
CNY 3,080.00 |
|
| LY406440 | Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 2 |
CNY 3,080.00 |
|
| LY424628 | Transient overexpression lysate of interleukin 1 receptor antagonist (IL1RN), transcript variant 3 |
CNY 3,080.00 |
|
| PH312460 | IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_000568) |
CNY 19,520.00 |
|
| PH318518 | IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776214) |
CNY 19,520.00 |
|
| TP302447 | Purified recombinant protein of Homo sapiens interleukin 1 receptor antagonist (IL1RN), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP312460 | Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP318518 | Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP720025 | Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 3 |
CNY 3,140.00 |
|
| TP760033 | Recombinant protein of human interleukin 1 receptor antagonist (IL1RN), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
