United States
Germany
Japan
United Kingdom
China
PCNA (NM_002592) Human Mass Spec Standard
CAT＃: PH301741
PCNA MS Standard C13 and N15-labeled recombinant protein (NP_002583)
View other "PCNA" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | PCNA MS Standard C13 and N15-labeled recombinant protein (NP_002583) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201741 |
| Predicted MW | 28.8 kDa |
| Protein Sequence |
>RC201741 protein sequence
Red=Cloning site Green=Tags(s) MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGV NLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMP SGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALR YLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002583 |
| RefSeq Size | 1355 |
| RefSeq ORF | 783 |
| Synonyms | ATLD2 |
| Locus ID | 5111 |
| Cytogenetics | 20p12.3 |
| Summary | The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | Base excision repair, Cell cycle, DNA replication, Mismatch repair, Nucleotide excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400929 | PCNA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405433 | PCNA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430596 | PCNA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400929 | Transient overexpression lysate of proliferating cell nuclear antigen (PCNA), transcript variant 1 |
CNY 3,080.00 |
|
| LY405433 | Transient overexpression lysate of proliferating cell nuclear antigen (PCNA), transcript variant 2 |
CNY 3,080.00 |
|
| LY430596 | Transient overexpression lysate of proliferating cell nuclear antigen (PCNA), transcript variant 2 |
CNY 3,080.00 |
|
| TP301741 | Recombinant protein of human proliferating cell nuclear antigen (PCNA), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP750150 | Purified recombinant protein of Human proliferating cell nuclear antigen (PCNA), transcript variant 2, full length, tag free, expressed in E.Coli, 50 ug |
CNY 2,040.00 |
|
| TP760481 | Purified recombinant protein of Human proliferating cell nuclear antigen (PCNA), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
