PAICS (NM_001079524) Human Mass Spec Standard
CAT#: PH301530
PAICS MS Standard C13 and N15-labeled recombinant protein (NP_001072992)
View other "PAICS" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PAICS MS Standard C13 and N15-labeled recombinant protein (NP_001072992) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201530 |
Predicted MW | 47.1 kDa |
Protein Sequence |
>RC201530 protein sequence
Red=Cloning site Green=Tags(s) MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQE AGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQW SEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVID NDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGH CEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISC PPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKI RECNL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001072992 |
RefSeq Size | 3329 |
RefSeq ORF | 1275 |
Synonyms | ADE2; ADE2H1; AIRC; PAIS |
Locus ID | 10606 |
Cytogenetics | 4q12 |
Summary | This gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416636 | PAICS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421514 | PAICS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421515 | PAICS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416636 | Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2 |
CNY 3,080.00 |
|
LY421514 | Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3 |
CNY 3,080.00 |
|
LY421515 | Transient overexpression lysate of phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 1 |
CNY 4,840.00 |
|
PH315225 | PAICS MS Standard C13 and N15-labeled recombinant protein (NP_006443) |
CNY 19,520.00 |
|
TP301530 | Recombinant protein of human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP315225 | Recombinant protein of human phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS), transcript variant 2, 20 µg |
CNY 2,900.00 |