NS4A protein (NC_004102) Virus Tagged ORF Clone
CAT#: VC102221
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for NS4A protein [Hepatitis C virus], codon optimized for human cell expression, NP_751925
View other clones from "Virus" (9)
Need custom modification / cloning service?
Get a free quote
CN¥ 1,200.00
CN¥ 3,800.00
Product images

Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102221 represents NCBI reference of NP_751925 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCACGTGGGTTCTGGTGGGGGGGGTGCTCGCTGCTCTGGCCGCTTACTGCCTGTCCACTGGATGTG TTGTGATAGTCGGACGCATCGTTCTTTCAGGAAAGCCTGCCATTATTCCTGATCGGGAAGTCCTGTACCA AGAGTTCGACGAAATGGAAGAGTGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102221 representing NP_751925
Red=Cloning sites Green=Tags MSTWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGKPAIIPDREVLYQEFDEMEEC TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_004102 |
ORF Size | 165 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_004102.1, NP_751925 |
RefSeq ORF | 165 bp |
MW | 5.9 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102214 | Myc-DDK-tagged ORF clone of viral ORF for protein F [Hepatitis C virus], codon optimized for human cell expression, NP_803170 |
CN¥ 1,200.00 |
|
VC102215 | Myc-DDK-tagged ORF clone of viral ORF for core protein [Hepatitis C virus], codon optimized for human cell expression, NP_751919 |
CN¥ 3,600.00 |
|
VC102216 | Myc-DDK-tagged ORF clone of viral ORF for E1 protein [Hepatitis C virus], codon optimized for human cell expression, NP_751920 |
CN¥ 2,400.00 |
|
VC102217 | Myc-DDK-tagged ORF clone of viral ORF for E2 protein [Hepatitis C virus], codon optimized for human cell expression, NP_751921 |
CN¥ 3,656.00 |
|
VC102218 | Myc-DDK-tagged ORF clone of viral ORF for p7 protein [Hepatitis C virus], codon optimized for human cell expression, NP_751922 |
CN¥ 1,200.00 |
|
VC102219 | Myc-DDK-tagged ORF clone of viral ORF for NS2 protein [Hepatitis C virus], codon optimized for human cell expression, NP_751923 |
CN¥ 2,400.00 |
|
VC102220 | Myc-DDK-tagged ORF clone of viral ORF for NS3 protease/helicase' [Hepatitis C virus], codon optimized for human cell expression, NP_803144 |
CN¥ 4,704.00 |
|
VC102222 | Myc-DDK-tagged ORF clone of viral ORF for NS4B protein [Hepatitis C virus], codon optimized for human cell expression, NP_751926 |
CN¥ 2,400.00 |
|
VC102223 | Myc-DDK-tagged ORF clone of viral ORF for NS5A protein [Hepatitis C virus], codon optimized for human cell expression, NP_751927 |
CN¥ 3,656.00 |
其它NS4A protein产品