matrix (NC_001802) Virus Tagged ORF Clone
CAT#: VC101724
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for matrix [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579876
View other clones from "Virus" (19)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
Cited in 1 publication. |
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101724 represents NCBI reference of NP_579876 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATGGGGGCTAGGGCATCAGTTTTGAGCGGCGGCGAGCTGGACAGATGGGAGAAAATTAGACTCAGAC CAGGGGGGAAGAAGAAGTATAAACTGAAACATATAGTGTGGGCATCACGGGAGCTTGAGCGCTTTGCCGT CAACCCTGGCCTCCTCGAAACCAGTGAGGGATGTAGACAGATCCTGGGCCAGTTGCAGCCTTCCTTGCAG ACGGGAAGTGAAGAACTGAGAAGTCTGTACAACACAGTGGCAACTCTGTATTGTGTGCATCAAAGAATCG AGATTAAAGACACCAAAGAGGCCTTGGACAAGATCGAAGAGGAGCAAAACAAGTCAAAGAAAAAGGCTCA ACAGGCAGCTGCCGATACCGGGCATTCCAACCAAGTGTCTCAAAACTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101724 representing NP_579876
Red=Cloning sites Green=Tags MMGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQ TGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNY TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001802 |
ORF Size | 399 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_001802.1, NP_579876 |
RefSeq ORF | 399 bp |
UniProt ID | P04585 |
MW | 15.0 kDa |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
HIV blocks Type I IFN signaling through disruption of STAT1 phosphorylation
,Nguyen, NV;Tran, JT;Sanchez, DJ;,
Innate Immun
,PubMed ID 30282499
[MATRIX]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101716 | Myc-DDK-tagged ORF clone of viral ORF for Tat [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057853 |
CNY 1,200.00 |
|
VC101717 | Myc-DDK-tagged ORF clone of viral ORF for Rev [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057854 |
CNY 1,200.00 |
|
VC101718 | Myc-DDK-tagged ORF clone of viral ORF for Pr55(Gag) [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057850 |
CNY 3,656.00 |
|
VC101719 | Myc-DDK-tagged ORF clone of viral ORF for Vif [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057851 |
CNY 2,400.00 |
|
VC101720 | Myc-DDK-tagged ORF clone of viral ORF for Vpr [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057852 |
CNY 1,200.00 |
|
VC101721 | Myc-DDK-tagged ORF clone of viral ORF for Envelope surface glycoprotein gp160, precursor [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057856 |
CNY 6,272.00 |
|
VC101722 | Myc-DDK-tagged ORF clone of viral ORF for Nef [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057857 |
CNY 2,400.00 |
|
VC101723 | Myc-DDK-tagged ORF clone of viral ORF for Vpu [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057855 |
CNY 1,200.00 |
|
VC101725 | Myc-DDK-tagged ORF clone of viral ORF for capsid [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579880 |
CNY 3,600.00 |
|
VC101726 | Myc-DDK-tagged ORF clone of viral ORF for nucleocapsid [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579881 |
CNY 1,800.00 |
|
VC101727 | Myc-DDK-tagged ORF clone of viral ORF for p2 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579882 |
CNY 1,200.00 |
|
VC101728 | Myc-DDK-tagged ORF clone of viral ORF for p6 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579883 |
CNY 1,800.00 |
|
VC101729 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579893 |
CNY 1,200.00 |
|
VC101730 | Myc-DDK-tagged ORF clone of viral ORF for Envelope transmembrane glycoprotein gp41 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579895 |
CNY 3,656.00 |
|
VC101732 | Myc-DDK-tagged ORF clone of viral ORF for retropepsin [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_705926 |
CNY 1,800.00 |
|
VC101735 | Myc-DDK-tagged ORF clone of viral ORF for p1 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_787042 |
CNY 1,200.00 |
|
VC101736 | Myc-DDK-tagged ORF clone of viral ORF for Gag-Pol Transframe peptide [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_787043 |
CNY 1,200.00 |
|
VC101737 | Myc-DDK-tagged ORF clone of viral ORF for reverse transcriptase p51 subunit [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_789739 |
CNY 3,656.00 |
|
VC101739 | Myc-DDK-tagged ORF clone of viral ORF for Envelope surface glycoprotein gp120 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579894 |
CNY 3,656.00 |