vpu (NC_001802) Virus Tagged ORF Clone
CAT#: VC101723
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for Vpu [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057855
View other clones from "Virus" (19)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101723 represents NCBI reference of NP_057855 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCAGCCTATCCCAATAGTGGCTATTGTGGCACTGGTGGTGGCCATCATCATAGCCATCGTCGTGTGGA GTATTGTTATAATCGAGTATCGCAAGATTCTGCGACAGCGGAAGATAGATCGGCTGATCGATCGGTTGAT TGAGCGCGCCGAAGATTCCGGCAATGAATCCGAAGGGGAAATTTCAGCCCTGGTCGAGATGGGAGTCGAA ATGGGGCATCATGCCCCCTGGGATGTCGACGACCTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101723 representing NP_057855
Red=Cloning sites Green=Tags MQPIPIVAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVE MGHHAPWDVDDL TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001802 |
ORF Size | 246 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_001802.1, NP_057855 |
RefSeq ORF | 246 bp |
Locus ID | 155945 |
UniProt ID | P04585 |
MW | 9.2 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101716 | Myc-DDK-tagged ORF clone of viral ORF for Tat [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057853 |
CNY 1,200.00 |
|
VC101717 | Myc-DDK-tagged ORF clone of viral ORF for Rev [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057854 |
CNY 1,200.00 |
|
VC101718 | Myc-DDK-tagged ORF clone of viral ORF for Pr55(Gag) [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057850 |
CNY 3,656.00 |
|
VC101719 | Myc-DDK-tagged ORF clone of viral ORF for Vif [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057851 |
CNY 2,400.00 |
|
VC101720 | Myc-DDK-tagged ORF clone of viral ORF for Vpr [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057852 |
CNY 1,200.00 |
|
VC101721 | Myc-DDK-tagged ORF clone of viral ORF for Envelope surface glycoprotein gp160, precursor [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057856 |
CNY 6,272.00 |
|
VC101722 | Myc-DDK-tagged ORF clone of viral ORF for Nef [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057857 |
CNY 2,400.00 |
|
VC101724 | Myc-DDK-tagged ORF clone of viral ORF for matrix [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579876 |
CNY 1,800.00 |
|
VC101725 | Myc-DDK-tagged ORF clone of viral ORF for capsid [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579880 |
CNY 3,600.00 |
|
VC101726 | Myc-DDK-tagged ORF clone of viral ORF for nucleocapsid [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579881 |
CNY 1,800.00 |
|
VC101727 | Myc-DDK-tagged ORF clone of viral ORF for p2 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579882 |
CNY 1,200.00 |
|
VC101728 | Myc-DDK-tagged ORF clone of viral ORF for p6 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579883 |
CNY 1,800.00 |
|
VC101729 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579893 |
CNY 1,200.00 |
|
VC101730 | Myc-DDK-tagged ORF clone of viral ORF for Envelope transmembrane glycoprotein gp41 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579895 |
CNY 3,656.00 |
|
VC101732 | Myc-DDK-tagged ORF clone of viral ORF for retropepsin [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_705926 |
CNY 1,800.00 |
|
VC101735 | Myc-DDK-tagged ORF clone of viral ORF for p1 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_787042 |
CNY 1,200.00 |
|
VC101736 | Myc-DDK-tagged ORF clone of viral ORF for Gag-Pol Transframe peptide [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_787043 |
CNY 1,200.00 |
|
VC101737 | Myc-DDK-tagged ORF clone of viral ORF for reverse transcriptase p51 subunit [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_789739 |
CNY 3,656.00 |
|
VC101739 | Myc-DDK-tagged ORF clone of viral ORF for Envelope surface glycoprotein gp120 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579894 |
CNY 3,656.00 |