HCoV-HKU1 nsp10 Gene Tagged ORF Clone
CAT#: VC100584
- TrueORF®
Myc-DDK-tagged ORF clone for nsp10 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459939
View other clones from "HCoV-HKU1" (18)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100584 represents NCBI reference of YP_459939 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTGGAGTGGCTACTGAATATGCCGCCAACTCATCAATTCTCTCCCTCTGTGCCTTCTCCGTTGATC CTAAAAAGACGTACCTTGACTACATTCAGCAGGGTGGGGTGCCAATCATCAATTGCGTCAAAATGCTGTG CGATCATGCCGGGACAGGGATGGCTATTACTATCAAGCCGGAAGCAACTATAAATCAAGATTCCTACGGG GGCGCATCAGTGTGTATCTATTGTCGAGCGCGCGTGGAACACCCGGATGTGGATGGGATTTGCAAGTTGA GAGGGAAGTTTGTTCAGGTGCCTCTTGGCATCAAAGACCCAATACTCTACGTTTTGACTCACGACGTATG TCAGGTCTGCGGTTTCTGGCGGGATGGCTCTTGCTCCTGCGTGGGTTCCAGCGTCGCAGTCCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100584 representing YP_459939
Red=Cloning sites Green=Tags MAGVATEYAANSSILSLCAFSVDPKKTYLDYIQQGGVPIINCVKMLCDHAGTGMAITIKPEATINQDSYG GASVCIYCRARVEHPDVDGICKLRGKFVQVPLGIKDPILYVLTHDVCQVCGFWRDGSCSCVGSSVAVQ TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_006577 |
ORF Size | 414 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_006577.2, YP_459939 |
RefSeq ORF | 414 bp |
MW | 14.7 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100570 | Myc-DDK-tagged ORF clone for hemagglutinin-esterase glycoprotein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173237 |
CNY 3,656.00 |
|
VC100572 | Myc-DDK-tagged ORF clone for non-structural protein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173239 |
CNY 3,800.00 |
|
VC100573 | Myc-DDK-tagged ORF clone for small membrane protein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173240 |
CNY 3,800.00 |
|
VC100574 | Myc-DDK-tagged ORF clone for membrane glycoprotein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173241 |
CNY 2,400.00 |
|
VC100575 | Myc-DDK-tagged ORF clone for nucleocapsid phosphoprotein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173242 |
CNY 5,488.00 |
|
VC100576 | Myc-DDK-tagged ORF clone for nucleocapsid phosphoprotein 2 [Human coronavirus HKU1], codon optimized for human cell expression, YP_173243 |
CNY 3,800.00 |
|
VC100577 | Myc-DDK-tagged ORF clone for nsp1 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460018 |
CNY 3,800.00 |
|
VC100578 | Myc-DDK-tagged ORF clone for nsp2 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459934 |
CNY 7,030.00 |
|
VC100579 | Myc-DDK-tagged ORF clone for nsp6 (hydrophobic domain) [Human coronavirus HKU1], codon optimized for human cell expression, YP_460019 |
CNY 3,800.00 |
|
VC100580 | Myc-DDK-tagged ORF clone for nsp5 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459936 |
CNY 3,800.00 |
|
VC100581 | Myc-DDK-tagged ORF clone for nsp7 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459938 |
CNY 3,800.00 |
|
VC100582 | Myc-DDK-tagged ORF clone for nsp8 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460020 |
CNY 3,800.00 |
|
VC100583 | Myc-DDK-tagged ORF clone for nsp9 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459943 |
CNY 3,800.00 |
|
VC100585 | Myc-DDK-tagged ORF clone for nsp13 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459942 |
CNY 7,220.00 |
|
VC100586 | Myc-DDK-tagged ORF clone for nsp14 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460021 |
CNY 6,370.00 |
|
VC100587 | Myc-DDK-tagged ORF clone for nsp15 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460022 |
CNY 4,470.00 |
|
VC100588 | Myc-DDK-tagged ORF clone for nsp16 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460023 |
CNY 3,800.00 |
|
VC100591 | Myc-DDK-tagged ORF clone for nsp4 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459935 |
CNY 6,080.00 |