IRF1 Rabbit Polyclonal Antibody
CN¥ 4,628.00
CN¥ 300.00
CN¥ 1,430.00
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Irf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 37 kDa |
Gene Name | interferon regulatory factor 1 |
Database Link | |
Background | Irf1 specifically binds toThe upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and activates those genes.Irf1 acts as a tumor suppressor. |
Synonyms | IRF-1; MAR |
Note | Immunogen Sequence Homology: Mouse: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Sheep: 85%; Bovine: 85%; Rabbit: 85%; Dog: 83%; Horse: 83%; Human: 83%; Yeast: 83% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |