IRF1 (NM_002198) Human Recombinant Protein
CAT#: TP303500
Recombinant protein of human interferon regulatory factor 1 (IRF1), 20 µg
View other "IRF1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203500 protein sequence
Red=Cloning site Green=Tags(s) MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEK EPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSC GDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLY NFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEI DSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002189 |
Locus ID | 3659 |
UniProt ID | P10914 |
Refseq Size | 3567 |
Cytogenetics | 5q31.1 |
Refseq ORF | 975 |
Synonyms | IRF-1; MAR |
Summary | The protein encoded by this gene is a transcriptional regulator and tumor suppressor, serving as an activator of genes involved in both innate and acquired immune responses. The encoded protein activates the transcription of genes involved in the body's response to viruses and bacteria, playing a role in cell proliferation, apoptosis, the immune response, and DNA damage response. This protein represses the transcription of several other genes. As a tumor suppressor, it both suppresses tumor cell growth and stimulates an immune response against tumor cells. Defects in this gene have been associated with gastric cancer, myelogenous leukemia, and lung cancer. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419474 | IRF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419474 | Transient overexpression lysate of interferon regulatory factor 1 (IRF1) |
CN¥ 3,080.00 |
|
PH303500 | IRF1 MS Standard C13 and N15-labeled recombinant protein (NP_002189) |
CN¥ 14,250.00 |