PIP4K2C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PIP4K2C antibody is: synthetic peptide directed towards the C-terminal region of Human PIP4K2C. Synthetic peptide located within the following region: LKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	phosphatidylinositol-5-phosphate 4-kinase type 2 gamma
Database Link	NP_079055 Entrez Gene 79837 Human UniProt ID Q8TBX8
Background	PIP4K2C may play an important role in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum.
Synonyms	PIP5K2C
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.