PIP4K2C (NM_001146258) Human Recombinant Protein
CAT#: TP328337
Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 2, 20 µg
View other "PIP4K2C" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228337 representing NM_001146258
Red=Cloning site Green=Tags(s) MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVM LLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGR FLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHR LPVHRKYDLKGSLVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMD YSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESF IDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF A myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001139730 |
Locus ID | 79837 |
UniProt ID | Q8TBX8 |
Cytogenetics | 12q13.3 |
Refseq ORF | 1263 |
Synonyms | PIP5K2C |
Summary | May play an important role in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411069 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431328 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431351 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431365 | PIP4K2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411069 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 1 |
CNY 3,080.00 |
|
LY431328 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 4 |
CNY 3,080.00 |
|
LY431351 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 3 |
CNY 3,080.00 |
|
LY431365 | Transient overexpression lysate of phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 2 |
CNY 3,080.00 |
|
PH305976 | PIP4K2C MS Standard C13 and N15-labeled recombinant protein (NP_079055) |
CNY 19,520.00 |
|
TP305976 | Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), 20 µg |
CNY 2,900.00 |
其它PIP4K2C产品