Recombinant M-CSF (Macrophage colony-stimulating factor),Mouse

CAT#: TP728366

Recombinant M-CSF (Macrophage colony-stimulating factor),Mouse



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP withpolyhistidine tag at the C-terminus
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 19.02 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce proliferation in NFS-60 cells. The ED₅₀ for this effect is <2 ng/mL. The specific activity of recombinant mouse M-CSF is approximately >5 x 10⁵ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P07141
Synonyms CSF-1, MGI-IM
Summary Macrophage Colony-Stimulating Factor (M-CSF) is a 19.02 kDa hematopoietic Growth Factors with 162 amino acid residues. The active form of the protein is homodimer, and secreted by osteoblasts. M-CSF controls the production, differentiation, and function of monocytes, macrophages, and bone marrow progenitor cells. M-CSF is able to activate CSF-1 signaling pathway via binding its receptor CSF-1R.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...