Recombinant RANKL (Receptor activator of nuclear factor kappa-Β ligand),Human

CAT#: TP728280

Recombinant RANKL (Receptor activator of nuclear factor kappa-Β ligand),Human



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 20.67 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED₅₀ for this effect is <10 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID O14788
Synonyms soluble Receptor Activator of NF-kB Ligand, TNFSF11, TRANCE (TNF-Related Activation-induced Cytokine), OPGL, ODF (Osteoclast Differentiation Factor), CD254,sRNAK Ligand
Summary Receptor activator of NF-κB (RANK) ligand (RANKL) is type II transmembrane protein with an extracellular domain at the carboxy-terminus of TNF cytokine superfamily. RANKL is a 19.8 kDa protein containing 317 residues and high express in T cells and T cell rich organs, such as thymus and lymph nodes. RANKL-RANK (RANKL receptor) plays an important role in bone metabolism, dysregulation, and immune system.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...