Recombinant IL-36 gamma (Interleukin-36 gamma),Human

CAT#: TP728266

Recombinant IL-36 gamma (Interleukin-36 gamma),Human



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 17.98 kDa. The protein migrates as19 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce IL-8 secretion in A431 cells. The ED₅₀ for this effect is <5 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID Q9NZH8
Synonyms IL-1F9, IL-1ε (epsilon), IL-1H1, L1RP2, IL-1RP2
Summary Interleukin-36 gamma (IL-36γ) consists of 134 amino acids. IL-36γ is a member of the interleukin-1 cytokine family. It plays a significant role in immune responses, particularly in inflammatory reactions, which are essential for binding with interleukin-1 receptor and serves as receptor agonists, enabling cytokine activity and generating pro-inflammatory.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...