Recombinant CCL4 (C-C motif chemokine ligand 4)，Human

Specifications

Product Data
Species	Human
Expression Host	E. coli
Expression cDNA Clone or AA Sequence	Protein Sequence (showhide) APMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN.
Tag	Tag Free
Predicted MW	The protein has a calculated MW of 7.75 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Purity	>98% as determined by SDS-PAGE.
Buffer	The protein was lyophilized from a 0.2 µm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.
Applications	Cell culture
Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity	Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED₅₀ for this effect is <10 ng/mL.
Endotoxin	<0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID	P13236
Synonyms	MIP-1b: Macrophage Inflammatory Protein-1β, ACT-2
Summary	C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1β (MIP-1β), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells and epithelial cells. CCL4 recruits various immune cells like natural killer cells, monocytes, and neutrophils when CCL4 binds to CCR5. In addition, CCL4 mediates lymphocyte adhesion by Rac1 /Cdc42 signaling pathway and plays critical roles in different biological functions like maintenance of cell polarity, regulation of calcium ion transport and response to viruses.

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.