Recombinant BMP-3 (Bone morphogenetic protein-3),Human

CAT#: TP728157

Recombinant BMP-3 (Bone morphogenetic protein-3),Human



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 13.34 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).
Purity >95% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is < 10 μg/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P12645
Synonyms Osteogenin, BMP-3A
Summary Bone Morphogenetic Protein-3 (BMP-3) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-3 can bind with TGF-β receptor and participate in SMAD protein signal transduction through triggering pathway-restricted SMAD protein phosphorylation. The primary function of BMP-3 is osteoblast differentiation and Induces bone formation.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...