Ipmk (NM_027184) Mouse Recombinant Protein

CAT#: TP506205

Purified recombinant protein of Mouse inositol polyphosphate multikinase (Ipmk), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206205 protein sequence
Red=Cloning site Green=Tags(s)

MAAEPPALRLRPPGSTGDSPPVPRLLGGCVPLSHQVAGHMYGKDKVGILQHPDGTVLKQLQPPPRGPREL
EFYTMVYAADCADAVLLELRKHLPKYYGVWSPPTAPNDVYLKLEDVTHKFNKPCIMDVKIGRKSYDPFAS
SEKIQQQVSKYPLMEEIGFLVLGMRVYHLHSDSYETQNQHYGRGLTKETLKEGVSKFFHNGFCLRKDAIA
ASIQKVEKILQWFENQKQLNFYASSLLFVYEGSSQPATTKANDRTLAGRFLSKGPLTDADGLECNNNFHL
FGAPPNGMSVGKSLSKAYSRHRKLYAKKHQSQTSLKVETLEQDNGWRSMSQEHLNGNVLAQLEKVFYHLP
AGRPEIPEAEVRMIDFAHVFPSNTVDEGYVYGLKHLIAVLRSILDS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 44.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_081460
Locus ID 69718
UniProt ID Q7TT16
Refseq Size 5432
Cytogenetics 10 B5.3
Refseq ORF 1191
Synonyms 2410017C19Rik; AA408208; Impk
Summary Inositol phosphate kinase with a broad substrate specificity. Phosphorylates inositol 1,4,5-trisphosphate (Ins(1,4,5)P3) first to inositol 1,3,4,5-tetrakisphosphate and then to inositol 1,3,4,5,6-pentakisphosphate (Ins(1,3,4,5,6)P5) (PubMed:15939867). Phosphorylates inositol 1,3,4,6-tetrakisphosphate (Ins(1,3,4,6)P4). Phosphorylates glycero-3-phospho-1D-myo-inositol 4,5-bisphosphate to glycero-3-phospho-1D-myo-inositol 3,4,5-trisphosphate. Plays an important role in MLKL-mediated necroptosis via its role in the biosynthesis of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Binding of these highly phosphorylated inositol phosphates to MLKL mediates the release of an N-terminal auto-inhibitory region, leading to activation of the kinase. Essential for activated phospho-MLKL to oligomerize and localize to the cell membrane during necroptosis (By similarity). Required for normal embryonic development, probably via its role in the biosynthesis of inositol 1,3,4,5,6-pentakisphosphate (Ins(1,3,4,5,6)P5) and inositol hexakisphosphate (InsP6) (PubMed:15939867).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...