Med8 (NM_020000) Mouse Recombinant Protein
CAT#: TP503549
Purified recombinant protein of Mouse mediator complex subunit 8 (Med8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203549 protein sequence
Red=Cloning site Green=Tags(s) MQREEKQLEASLDALLNQVADLKNSLGSFIYKLENEYDRLTWPSVLDSFALLSGQLNTLNKVLKHEKTPL FRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQI QSLNKMCSNLLEKISKEERESESGGLRPNKQTFNPGDTNALVAAVAFGKGLSNWRPSGSSGPGQPGQPGA GTILAGASGLPQVQMPGAPNQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 29.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064384 |
Locus ID | 80509 |
UniProt ID | Q9D7W5 |
Refseq Size | 1887 |
Cytogenetics | 4 |
Refseq ORF | 807 |
Synonyms | 2210021A15Rik; AB041805; ARC32 |
Summary | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May play a role as a target recruitment subunit in E3 ubiquitin-protein ligase complexes and thus in ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |