Hes6 (NM_019479) Mouse Recombinant Protein

CAT#: TP502615

Purified recombinant protein of Mouse hairy and enhancer of split 6 (Hes6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
Rabbit Polyclonal Anti-Hes6 Antibody
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202615 protein sequence
Red=Cloning site Green=Tags(s)

MAPSQAPSRDRAGQEDEDRWEARGDRKARKPLVEKKRRARINESLQELRLLLAGTEVQAKLENAEVLELT
VRRVQGALRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVSAELLNHLLESMPLREGSS
FQDLLGDSLAGLPGGSGRSSWPPGGSPESPLSSPPGPGDDLCSDLEEIPEAELNRVPAEGPDLVSTSLGS
LTAARRAQSVWRPW

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 24.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_062352
Locus ID 55927
UniProt ID Q9JHE6
Refseq Size 1335
Cytogenetics 1 D
Refseq ORF 675
Synonyms AI326893; bHLHb41
Summary Does not bind DNA itself but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. Also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCF3/E47, allowing ASCL1 and TCF3 to up-regulate transcription in its presence. Promotes cell differentiation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...