Hes6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Hes6 Antibody is: synthetic peptide directed towards the middle region of Mouse Hes6. Synthetic peptide located within the following region: LLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	hairy and enhancer of split 6
Database Link	NP_062352 Entrez Gene 55927 Mouse UniProt ID Q9JHE6
Background	Hes6 does not bind DNA itself but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. Hes6 also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCF3/E47, allowing ASCL1 and TCF3 to up-regulate transcription in its presence. It promotes cell differentiation.
Synonyms	bHLHb41; bHLHc23; C-HAIRY1; HES-6
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%; Horse: 75%; Rabbit: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.