Sra1 (NM_025291) Mouse Recombinant Protein

CAT#: TP502517

Purified recombinant protein of Mouse steroid receptor RNA activator 1 (Sra1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
Rabbit Polyclonal Anti-Sra1 Antibody
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202517 protein sequence
Red=Cloning site Green=Tags(s)

MAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLTKRVAAPQDGSPRAPETSGPPPVDHPPPSSKAS
RPPPMGSCPATGVEPPSSPVIESETLIEDVLRPLEQALEDCHGHTKKQVCDDISRRLVLLREQWAGGKLS
IPVKKRMALLVQELLHHQWDAADDIHRSLMVDYVTEVSQWMVGVKRLIAEKRSLSSEETKEEKFTVEPEN
QTIPGFQQPS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 24.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079567
Locus ID 24068
UniProt ID Q80VJ2
Refseq Size 979
Cytogenetics 18 B2
Refseq ORF 663
Synonyms AA959952; Sra; Srap; Straa1; Strra1
Summary Functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Also mediates transcriptional coactivation of steroid receptors ligand-dependently through the steroid-binding domain (AF-2). Enhances cellular proliferation and differentiation and promotes apoptosis in vivo. May play a role in tumorigenesis (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...