Sra1 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 7,106.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Sra1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 24 kDa |
Gene Name | steroid receptor RNA activator 1 |
Database Link | |
Background | Sra1 is a functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Sra1 also mediates transcriptional coactivation of steroid receptors ligand-dependently through the steroid-binding domain (AF-2).Sra1 enhances cellular proliferation and differentiation and promotes apoptosis in vivo. Sra1 may play a role in tumorigenesis. |
Synonyms | MGC87674; pp7684; SRA; SRAP; STRAA1 |
Note | Immunogen sequence homology: Dog: 93%; Pig: 93%; Rat: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Horse: 86%; Bovine: 86%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |