Sra1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Sra1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	steroid receptor RNA activator 1
Database Link	NP_079567 Entrez Gene 24068 Mouse UniProt ID Q80VJ2
Background	Sra1 is a functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Sra1 also mediates transcriptional coactivation of steroid receptors ligand-dependently through the steroid-binding domain (AF-2).Sra1 enhances cellular proliferation and differentiation and promotes apoptosis in vivo. Sra1 may play a role in tumorigenesis.
Synonyms	MGC87674; pp7684; SRA; SRAP; STRAA1
Note	Immunogen sequence homology: Dog: 93%; Pig: 93%; Rat: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Horse: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.