SLC30A7 (NM_001144884) Human Recombinant Protein
CAT#: TP327524
Recombinant protein of human solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 2, 20 µg
View other "SLC30A7" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227524 representing NM_001144884
Red=Cloning site Green=Tags(s) MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFH MFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHER LLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAH GHGHFHSHDGPSLKETTGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVV SVIPLLRESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARW ILSQTHNIFTQAGVRQLYVQIDFAAM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138356 |
Locus ID | 148867 |
UniProt ID | Q8NEW0 |
Cytogenetics | 1p21.2 |
Refseq ORF | 1128 |
Synonyms | ZnT-7; ZNT7; ZnTL2 |
Summary | Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellular signal ion. Members of the zinc transporter (ZNT)/SLC30 subfamily of the cation diffusion facilitator family, such as SLC30A7, permit cellular efflux of zinc (Seve et al., 2004 [PubMed 15154973]).[supplied by OMIM, Mar 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408825 | SLC30A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428544 | SLC30A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408825 | Transient overexpression lysate of solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 1 |
CNY 3,080.00 |
|
LY428544 | Transient overexpression lysate of solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 2 |
CNY 3,080.00 |
|
PH309198 | SLC30A7 MS Standard C13 and N15-labeled recombinant protein (NP_598003) |
CNY 19,520.00 |
|
PH327524 | SLC30A7 MS Standard C13 and N15-labeled recombinant protein (NP_001138356) |
CNY 19,520.00 |
|
TP309198 | Recombinant protein of human solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它SLC30A7产品