SLC30A7 (NM_133496) Human Mass Spec Standard
CAT#: PH309198
SLC30A7 MS Standard C13 and N15-labeled recombinant protein (NP_598003)
View other "SLC30A7" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | SLC30A7 MS Standard C13 and N15-labeled recombinant protein (NP_598003) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209198 |
Predicted MW | 41.6 kDa |
Protein Sequence |
>RC209198 protein sequence
Red=Cloning site Green=Tags(s) MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFH MFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHER LLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAH GHGHFHSHDGPSLKETTGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVV SVIPLLRESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARW ILSQTHNIFTQAGVRQLYVQIDFAAM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_598003 |
RefSeq Size | 8232 |
RefSeq ORF | 1128 |
Synonyms | ZnT-7; ZNT7; ZnTL2 |
Locus ID | 148867 |
Cytogenetics | 1p21.2 |
Summary | Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellular signal ion. Members of the zinc transporter (ZNT)/SLC30 subfamily of the cation diffusion facilitator family, such as SLC30A7, permit cellular efflux of zinc (Seve et al., 2004 [PubMed 15154973]).[supplied by OMIM, Mar 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408825 | SLC30A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428544 | SLC30A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408825 | Transient overexpression lysate of solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 1 |
CNY 3,080.00 |
|
LY428544 | Transient overexpression lysate of solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 2 |
CNY 3,080.00 |
|
PH327524 | SLC30A7 MS Standard C13 and N15-labeled recombinant protein (NP_001138356) |
CNY 19,520.00 |
|
TP309198 | Recombinant protein of human solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP327524 | Recombinant protein of human solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它SLC30A7产品