United States
Germany
Japan
United Kingdom
China
Poliovirus Receptor (PVR) (NM_001135769) Human Recombinant Protein
CAT＃: TP327222
Purified recombinant protein of Homo sapiens poliovirus receptor (PVR), transcript variant 3, 20 µg
View other "Poliovirus Receptor" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227222 representing NM_001135769
Red=Cloning site Green=Tags(s) MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHG ESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLR VLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVP SSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWS TTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKGTEHASASANGHVSYSAVSR ENSSSQDPQTEGTR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001129241 |
| Locus ID | 5817 |
| UniProt ID | P15151 |
| Cytogenetics | 19q13.31 |
| Refseq ORF | 1092 |
| Synonyms | CD155; HVED; Necl-5; NECL5; PVS; TAGE4 |
| Summary | The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401951 | PVR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427700 | PVR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427701 | PVR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401951 | Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 1 |
CNY 3,080.00 |
|
| LY427700 | Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 2 |
CNY 3,080.00 |
|
| LY427701 | Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 3 |
CNY 3,080.00 |
|
| PH327222 | PVR MS Standard C13 and N15-labeled recombinant protein (NP_001129241) |
CNY 14,250.00 |
|
| TP720486 | Recombinant protein of human poliovirus receptor (PVR), transcript variant 2 |
CNY 3,140.00 |
|
| TP723950 | Human CD155 Protein, mFc-His tag |
CNY 5,552.00 |
|
| TP724018 | Human CD155 Protein, hFc tag |
CNY 5,876.00 |
其它Poliovirus Receptor产品
