MYL12B (NM_001144946) Human Recombinant Protein
CAT#: TP327035
Purified recombinant protein of Homo sapiens myosin, light chain 12B, regulatory (MYL12B), transcript variant 4, 20 µg
View other "MYL12B" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227035 representing NM_001144946
Red=Cloning site Green=Tags(s) MSSMFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLT MFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIE FTRILKHGAKDKDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138418 |
Locus ID | 103910 |
UniProt ID | O14950 |
Cytogenetics | 18p11.31 |
Refseq ORF | 462 |
Synonyms | MLC-B; MRLC2 |
Summary | The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).[supplied by OMIM, Mar 2008] |
Protein Pathways | Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403261 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428596 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428597 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428598 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403261 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 2 |
CN¥ 3,080.00 |
|
LY428596 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 1 |
CN¥ 3,080.00 |
|
LY428597 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 3 |
CN¥ 3,080.00 |
|
LY428598 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 4 |
CN¥ 3,080.00 |
|
PH301372 | MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_291024) |
CN¥ 19,520.00 |
|
PH327035 | MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_001138418) |
CN¥ 14,250.00 |
|
TP301372 | Recombinant protein of human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, 20 µg |
CN¥ 2,900.00 |