United States
Germany
Japan
United Kingdom
China
MYL12B (NM_033546) Human Mass Spec Standard
CAT＃: PH301372
MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_291024)
View other "MYL12B" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_291024) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201372 |
| Predicted MW | 19.8 kDa |
| Protein Sequence |
>RC201372 protein sequence
Red=Cloning site Green=Tags(s) MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYL DAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVD ELYREAPIDKKGNFNYIEFTRILKHGAKDKDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_291024 |
| RefSeq Size | 1022 |
| RefSeq ORF | 516 |
| Synonyms | MLC-B; MRLC2 |
| Locus ID | 103910 |
| Cytogenetics | 18p11.31 |
| Summary | The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).[supplied by OMIM, Mar 2008] |
| Protein Pathways | Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403261 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428596 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428597 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428598 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403261 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 2 |
CNY 3,080.00 |
|
| LY428596 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 1 |
CNY 3,080.00 |
|
| LY428597 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 3 |
CNY 3,080.00 |
|
| LY428598 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 4 |
CNY 3,080.00 |
|
| PH327035 | MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_001138418) |
CNY 14,250.00 |
|
| TP301372 | Recombinant protein of human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP327035 | Purified recombinant protein of Homo sapiens myosin, light chain 12B, regulatory (MYL12B), transcript variant 4, 20 µg |
CNY 2,900.00 |
