United States
Germany
Japan
United Kingdom
China
DSN1 (NM_001145316) Human Recombinant Protein
CAT＃: TP326614
Recombinant protein of human DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 1, 20 µg
View other "DSN1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226614 representing NM_001145316
Red=Cloning site Green=Tags(s) MTSVTRSEIIDEKGPVMSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQ ERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLS SFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAE MKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQN QSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGS GSGSCQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001138788 |
| Locus ID | 79980 |
| UniProt ID | Q9H410 |
| Cytogenetics | 20q11.23 |
| Refseq ORF | 1068 |
| Synonyms | C20orf172; dJ469A13.2; hKNL-3; KNL3; MIS13 |
| Summary | This gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex. The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411014 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428819 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428821 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411014 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 3 |
CNY 3,080.00 |
|
| LY428819 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 1 |
CNY 3,080.00 |
|
| LY428821 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 5 |
CNY 3,080.00 |
|
| PH316609 | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_079194) |
CNY 19,520.00 |
|
| PH326614 | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138788) |
CNY 19,520.00 |
|
| PH326656 | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138790) |
CNY 14,250.00 |
|
| TP316609 | Recombinant protein of human DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP326656 | Purified recombinant protein of Homo sapiens DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 5, 20 µg |
CNY 2,900.00 |
