United States
Germany
Japan
United Kingdom
China
DSN1 (NM_001145318) Human Mass Spec Standard
CAT＃: PH326656
DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138790)
View other "DSN1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138790) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226656 |
| Predicted MW | 38.1 kDa |
| Protein Sequence |
>RC226656 representing NM_001145318
Red=Cloning site Green=Tags(s) MSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQERLQSKSLHLSPQEQS ASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDT KGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAEMKEYITKFSLERQTWD QLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQ GSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSCQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138790 |
| RefSeq ORF | 1020 |
| Synonyms | C20orf172; dJ469A13.2; hKNL-3; KNL3; MIS13 |
| Locus ID | 79980 |
| Cytogenetics | 20q11.23 |
| Summary | This gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex. The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411014 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428819 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428821 | DSN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411014 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 3 |
CNY 3,080.00 |
|
| LY428819 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 1 |
CNY 3,080.00 |
|
| LY428821 | Transient overexpression lysate of DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 5 |
CNY 3,080.00 |
|
| PH316609 | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_079194) |
CNY 19,520.00 |
|
| PH326614 | DSN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138788) |
CNY 19,520.00 |
|
| TP316609 | Recombinant protein of human DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP326614 | Recombinant protein of human DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP326656 | Purified recombinant protein of Homo sapiens DSN1, MIND kinetochore complex component, homolog (S. cerevisiae) (DSN1), transcript variant 5, 20 µg |
CNY 2,900.00 |
