DAXX (NM_001141969) Human Recombinant Protein
CAT#: TP326603
Recombinant protein of human death-domain associated protein (DAXX), transcript variant 1, 20 µg
View other "DAXX" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226603 protein sequence
Red=Cloning site Green=Tags(s) MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEF LELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAK KKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKEL DLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGP DTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDP ALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGK DGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEE SPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCK KSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCI PSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 81.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Pull-down assay (PMID: 28497778) |
Reference Data | |
RefSeq | NP_001135441 |
Locus ID | 1616 |
UniProt ID | Q9UER7 |
Refseq Size | 2632 |
Cytogenetics | 6p21.32 |
Refseq ORF | 2220 |
Synonyms | BING2; DAP6; EAP1; SMIM40 |
Summary | This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), MAPK signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
PTEN regulates glioblastoma oncogenesis through chromatin-associated complexes of DAXX and histone H3.3
,Benitez, JA;Ma, J;D'Antonio, M;Boyer, A;Camargo, MF;Zanca, C;Kelly, S;Khodadadi-Jamayran, A;Jameson, NM;Andersen, M;Miletic, H;Saberi, S;Frazer, KA;Cavenee, WK;Furnari, FB;,
Nat Commun
,PubMed ID 28497778
[DAXX]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400540 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC427986 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC427987 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400540 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 2 |
CNY 4,840.00 |
|
LY427986 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 1 |
CNY 4,840.00 |
|
LY427987 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 3 |
CNY 4,840.00 |
|
PH319497 | DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001341) |
CNY 19,520.00 |
|
PH326603 | DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135441) |
CNY 19,520.00 |
|
PH327435 | DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135442) |
CNY 19,520.00 |
|
TP319497 | Recombinant protein of human death-domain associated protein (DAXX), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP327435 | Recombinant protein of human death-domain associated protein (DAXX), transcript variant 3, 20 µg |
CNY 2,900.00 |