United States
Germany
Japan
United Kingdom
China
DAXX (NM_001141970) Human Mass Spec Standard
CAT＃: PH327435
DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135442)
View other "DAXX" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135442) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227435 |
| Predicted MW | 82.7 kDa |
| Protein Sequence |
>RC227435 representing NM_001141970
Red=Cloning site Green=Tags(s) MRGSENCGEGRLERRFLSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKC YKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYIN ELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALY VAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVN RRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGC HLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADT PEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDE EEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESN GEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVS PHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDS PSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001135442 |
| RefSeq ORF | 2256 |
| Synonyms | BING2; DAP6; EAP1; SMIM40 |
| Locus ID | 1616 |
| Cytogenetics | 6p21.32 |
| Summary | This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Amyotrophic lateral sclerosis (ALS), MAPK signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400540 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC427986 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC427987 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY400540 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 2 |
CNY 4,840.00 |
|
| LY427986 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 1 |
CNY 4,840.00 |
|
| LY427987 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 3 |
CNY 4,840.00 |
|
| PH319497 | DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001341) |
CNY 19,520.00 |
|
| PH326603 | DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135441) |
CNY 19,520.00 |
|
| TP319497 | Recombinant protein of human death-domain associated protein (DAXX), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP326603 | Recombinant protein of human death-domain associated protein (DAXX), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP327435 | Recombinant protein of human death-domain associated protein (DAXX), transcript variant 3, 20 µg |
CNY 2,900.00 |
