United States
Germany
Japan
United Kingdom
China
Secretogranin V (SCG5) (NM_001144757) Human Recombinant Protein
CAT＃: TP326541
Recombinant protein of human secretogranin V (7B2 protein) (SCG5), transcript variant 1, 20 µg
View other "Secretogranin V" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226541 representing NM_001144757
Red=Cloning site Green=Tags(s) MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVG PQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFS REFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDP E myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001138229 |
| Locus ID | 6447 |
| UniProt ID | P05408 |
| Cytogenetics | 15q13.3 |
| Refseq ORF | 633 |
| Synonyms | 7B2; P7B2; SGNE1; SgV |
| Summary | This gene encodes a secreted chaperone protein that prevents the aggregation of other secreted proteins, including proteins that are associated with neurodegenerative and metabolic disease. The encoded protein may be best known for its role in the trafficking and activation of prohormone convertase PC2 (encoded by Gene ID: 5126). Phosphorylation of the encoded protein has been shown to have an inhibitory effect on its chaperone function. This gene also produces a ARHGAP11A-SCG5 readthrough transcript and ARHGAP11A-SCG5 protein. [provided by RefSeq, Feb 2019] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418950 | SCG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428502 | SCG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418950 | Transient overexpression lysate of secretogranin V (7B2 protein) (SCG5), transcript variant 2 |
CNY 3,080.00 |
|
| LY428502 | Transient overexpression lysate of secretogranin V (7B2 protein) (SCG5), transcript variant 1 |
CNY 3,080.00 |
|
| PH302772 | SCG5 MS Standard C13 and N15-labeled recombinant protein (NP_003011) |
CNY 19,520.00 |
|
| PH326541 | SCG5 MS Standard C13 and N15-labeled recombinant protein (NP_001138229) |
CNY 19,520.00 |
|
| TP302772 | Recombinant protein of human secretogranin V (7B2 protein) (SCG5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP701094 | Purified recombinant protein of Human secretogranin V (7B2 protein) (SCG5), Tyr27-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50 ug |
CNY 7,490.00 |
其它Secretogranin V产品
