United States
Germany
Japan
United Kingdom
China
Secretogranin V (SCG5) (NM_001144757) Human Mass Spec Standard
CAT＃: PH326541
SCG5 MS Standard C13 and N15-labeled recombinant protein (NP_001138229)
View other "Secretogranin V" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | SCG5 MS Standard C13 and N15-labeled recombinant protein (NP_001138229) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226541 |
| Predicted MW | 23.5 kDa |
| Protein Sequence |
>RC226541 representing NM_001144757
Red=Cloning site Green=Tags(s) MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVG PQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFS REFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDP E myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138229 |
| RefSeq ORF | 633 |
| Synonyms | 7B2; P7B2; SGNE1; SgV |
| Locus ID | 6447 |
| Cytogenetics | 15q13.3 |
| Summary | This gene encodes a secreted chaperone protein that prevents the aggregation of other secreted proteins, including proteins that are associated with neurodegenerative and metabolic disease. The encoded protein may be best known for its role in the trafficking and activation of prohormone convertase PC2 (encoded by Gene ID: 5126). Phosphorylation of the encoded protein has been shown to have an inhibitory effect on its chaperone function. This gene also produces a ARHGAP11A-SCG5 readthrough transcript and ARHGAP11A-SCG5 protein. [provided by RefSeq, Feb 2019] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418950 | SCG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428502 | SCG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418950 | Transient overexpression lysate of secretogranin V (7B2 protein) (SCG5), transcript variant 2 |
CNY 3,080.00 |
|
| LY428502 | Transient overexpression lysate of secretogranin V (7B2 protein) (SCG5), transcript variant 1 |
CNY 3,080.00 |
|
| PH302772 | SCG5 MS Standard C13 and N15-labeled recombinant protein (NP_003011) |
CNY 19,520.00 |
|
| TP302772 | Recombinant protein of human secretogranin V (7B2 protein) (SCG5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP326541 | Recombinant protein of human secretogranin V (7B2 protein) (SCG5), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP701094 | Purified recombinant protein of Human secretogranin V (7B2 protein) (SCG5), Tyr27-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50 ug |
CNY 7,490.00 |
其它Secretogranin V产品
