GRIA1 (NM_001114183) Human Recombinant Protein
CAT#: TP326253
Recombinant protein of human glutamate receptor, ionotropic, AMPA 1 (GRIA1), transcript variant 2, 20 µg
View other "GRIA1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226253 representing NM_001114183
Red=Cloning site Green=Tags(s) MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEM TYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHY KWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLN AILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTR VDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLT GNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAV APLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRF SPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSY TANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTT EEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQ GVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 101.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vitro ubiquitination assay substrate (PMID: 28212375) In vitro ubiquitination assay substrate (PMID: 29771335) |
Reference Data | |
RefSeq | NP_001107655 |
Locus ID | 2890 |
UniProt ID | P42261 |
Cytogenetics | 5q33.2 |
Refseq ORF | 2718 |
Synonyms | GluA1; GLUH1; GLUR1; GLURA; HBGR1 |
Summary | Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Glutamate Receptors, Transmembrane |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Long-term depression, Long-term potentiation, Neuroactive ligand-receptor interaction |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Loss of Fragile X Protein FMRP Impairs Homeostatic Synaptic Downscaling through Tumor Suppressor p53 and Ubiquitin E3 Ligase Nedd4-2
,Lee, KY;Jewett, KA;Chung, HJ;Tsai, NP;,
Hum. Mol. Genet.
,PubMed ID 29771335
[GRIA1]
|
Epilepsy-associated gene Nedd4-2 mediates neuronal activity and seizure susceptibility through AMPA receptors
,Zhu, J;Lee, KY;Jewett, KA;Man, HY;Chung, HJ;Tsai, NP;,
PLoS Genet
,PubMed ID 28212375
[GRIA1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400293 | GRIA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC426474 | GRIA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400293 | Transient overexpression lysate of glutamate receptor, ionotropic, AMPA 1 (GRIA1), transcript variant 1 |
CNY 4,840.00 |
|
LY426474 | Transient overexpression lysate of glutamate receptor, ionotropic, AMPA 1 (GRIA1), transcript variant 2 |
CNY 4,840.00 |
|
PH326253 | GRIA1 MS Standard C13 and N15-labeled recombinant protein (NP_001107655) |
CNY 19,520.00 |